DPCstruct | MC35592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 149 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02252 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820S3Z1 | 29-177 | NLSNIQSNKLINDLIKLIKYYFEKYLLSSIIIRCYIQIHVPSSQSGNNQGVNIQNQILKELDDMKIIIETNENIFIDYYKKHYEILK… |
| A0A7J8D0W6 | 7-146 | KSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKY… |
| A0A2R7WEU5 | 2-111 | None |
| E4Y751 | 108-272 | None |
| A0A7N4NSK5 | 31-187 | None |
| A0A7J6PDD8 | 272-481 | None |
| A0A5S6QS74 | 16-164 | None |
| A0A813YDG3 | 862-1021 | None |
| S9XAU6 | 2-122 | None |
| T1JYH4 | 813-963 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.