DPCstruct | MC35591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 97.30 |
| Assigned Pfam label(s) | PF12825- CL0103- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RRW5 | 328-431 | SPQRFWGTYRSNLYFGIKHRSSRSLSGGLMWFDYNKLQQSNDRFLRHWCDQNDRLKYGWTHHDGETFGIEQIYDDHLHLNIQWLKQI… |
| A0A7D9H1Y0 | 3-104 | DKTLLWGPYRPNVYVGMRPRVPKGVMMGLSWFGANDYRQIREVRHQCVIEDDMGKFGWTEYDPRLGGKGVIEDKNLDLTMNIKLVKG… |
| A0A812D903 | 46-147 | None |
| A0A7J7QNI1 | 73-181 | None |
| A0A813V7P3 | 367-474 | None |
| A0A7S1Y185 | 90-194 | None |
| A0A7R9PVJ4 | 27-131 | None |
| A0A5B6V8Z6 | 110-210 | None |
| A0A6J1W9C5 | 77-186 | None |
| A0A814MT57 | 3-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.