DPCstruct | MC35589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 625 |
|---|---|
| Mean domain length (aa) | 129 ± 31 aa |
| Standard deviation of domain lengths | 30.91 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.64 |
| Pfam Score | 98.14 |
| Assigned Pfam label(s) | CL0274- CL0125- PF05907- PF16662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820R208 | 11-128 | EKQPPSTVISFIQSQKGKPLLVLDKYLFKLNKPTTTKKYWICTLIECSAKIHTNINDHFIKMIGEHCHPAESERIDVREFRKNVKHR… |
| A0A7M7PH62 | 2-142 | EWIDTERGGLKLLLDGFIYVRKKDLANGWESFECELRRNRNECKARVKVLGADEFRDKTEHNHPPDHGKADAYKLKAAMKRRAVSTD… |
| A0A819RT15 | 116-277 | None |
| A0A5S6QKC2 | 6-86 | None |
| A0A0C2IVM4 | 19-117 | None |
| A0A0C2JAJ9 | 8-125 | None |
| A0A0C2MHT3 | 1-131 | None |
| A0A0C2MPZ9 | 50-121 | None |
| A0A1B0C3D8 | 143-239 | None |
| A0A7R9A2F6 | 18-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.