DPCstruct | MC35587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 56.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820Q950 | 102-195 | QQRGHFGQHDIFTGIENLYEGITICHSIYSTPASRTKFTIIATATDGNSSIVVYDPPATSTEGRLCLDCDFTKLYRKWDSAGTARYI… |
| G0QSU6 | 11-108 | KILTGSENLVQGTFDKNHPISYGVNNLYEGVTICHPQKIHNDFKVYAYNSNNQPLVVYSEANEWHGRIIVDCGFTKHWDGYWQKAGQ… |
| A0A814AA44 | 322-410 | None |
| F0ZKN4 | 359-456 | None |
| A0A815CLX8 | 885-981 | None |
| A0A813XCY0 | 123-228 | None |
| A0A821J8T7 | 1-101 | None |
| A0A813S8B2 | 308-408 | None |
| A0A819WR37 | 303-394 | None |
| A0A820CXU5 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.