DPCstruct | MC35585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 207 ± 17 aa |
| Standard deviation of domain lengths | 17.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820ACF4 | 6-199 | SFGDMISELDQMINHLTSQINVEFIIKETTISETKREELFKNVIDAVNTLRKINITFKDILLSPIDIDGYERDIKAKIEKMTNQLQT… |
| A0A820NWT0 | 1-232 | MYYDMHSNRDTLLDAMIRSLKELTSYSQMLQSIFRKIEELKNELINQELLNSDTQEFSKNRDEFYRKLNEKIFTLNQAKILIHFNMQ… |
| A0A814K2I2 | 1-218 | None |
| A0A817IQP1 | 1-194 | None |
| A0A821GL75 | 60-294 | None |
| A0A817P9L9 | 8-224 | None |
| A0A817D0C7 | 324-531 | None |
| A0A821B2K1 | 1-176 | None |
| A0A819IDS0 | 286-481 | None |
| A0A820QCW8 | 113-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.