DPCstruct | MC35581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820MTI9 | 1-167 | DENNGKITLKGFSIHHQELKKIFERWQKLIQQIQSAEEYYNQRTNKNIQFLLRTIHRLHPKNPTYWKPYCNSLVKLINQKYDNYVQK… |
| A0A819GWM0 | 381-515 | QVHHDEFKLVLKRIQILSNVTQSAKTFYQRQLNAIMKSIIQKMTKQIHSSQDWQSYTKYFQQLIQNKIQECVKLFDEYITNESKVIV… |
| A0A816SL46 | 67-195 | None |
| A0A820XAS6 | 617-747 | None |
| A0A820I3T4 | 1-147 | None |
| A0A817GWD4 | 420-586 | None |
| A0A819W0R1 | 212-375 | None |
| A0A816ZZS4 | 230-389 | None |
| A0A815ARM8 | 996-1126 | None |
| A0A820PN21 | 67-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.