DPCstruct | MC35580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3FLR1 | 1-90 | MPSCWLVLFRFWLRVDHVLLRLRETRLMAIFGGGGVTPRVVREVSEREQTWEEMVAQGRSPNPILYRDADEVAQWLPLTAKTLEQAT… |
| A0A6G1NTS1 | 131-217 | QRMLLLCRLFMRLDNVLVRIRDTRVYVDFAEDYVLREYTAKEDSWANVKRSLFMSGRLPDDITIALRDANLLSTLLPTVGRKIEEVK |
| A0A2U1QMD9 | 262-347 | None |
| A0A2G5UK67 | 443-518 | None |
| A0A2G5ULI0 | 62-142 | None |
| A0A093XQN1 | 168-252 | None |
| A0A0N1IIN3 | 241-308 | None |
| U4TYL2 | 64-144 | None |
| A0A507CTD5 | 440-535 | None |
| H3HEG3 | 598-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.