DPCstruct | MC3558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8TGX5 | 396-474 | YQSAIEIARNTEDDLDSNVADYLESAVNSMQLNIESYPDSYVLSKDEFAVFNYFRSRFSGEVAEHAVDRYWRSTMLDEN |
| A0A1A7MEP4 | 37-113 | VLDIQRALDIARNTEGDLDHSVAKYLEEQLAGVWNRLESRPDSYVLSKDEFAIFNFFIGRYQESTVAEKAIARFWSS |
| T0KHQ4 | 27-118 | None |
| A0A167D9Z4 | 78-167 | None |
| A0A194WA56 | 81-162 | None |
| A0A179I643 | 13-118 | None |
| C4JTB6 | 1-94 | None |
| A0A3N2PIU4 | 172-267 | None |
| C1GP67 | 9-92 | None |
| A0A369GAQ6 | 25-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.