DPCstruct | MC35577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2W204 | 348-444 | AQFLMYAHTSSGRWLNHAAKPLIIGLKSTVTETAHFVGIPCAKPNEIKRNSFGRIFREAARMINVQFKCSSFETSSVQLETVDVQKF… |
| A0A7S3BVI2 | 11-90 | KNKYRHKPLIIIVPVPGTEPPQKLVMGIPPTPRHASKRSNQFELAFRTAADVDYLAEGFDGSMVQIESDAFQRFLIKLKT |
| A0A183HEJ8 | 103-212 | None |
| D3BKP9 | 686-769 | None |
| A0A1V9ZXW5 | 597-683 | None |
| L1K0Q3 | 747-832 | None |
| A0A2A4K7M8 | 687-766 | None |
| A0A1J8QI14 | 1080-1161 | None |
| A0A7J6PQR2 | 56-131 | None |
| A0A226F0S4 | 479-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.