DPCstruct | MC35575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 10 aa |
| Standard deviation of domain lengths | 9.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3BNX2 | 1-147 | SVSRMRAAVVKASTSGALDEGVVANAYAWIRKASEDGLDGMVVILQRVLQLYAQSALPAEGGSPIAQLIDKVVASDEEQWDALLREG… |
| A0A836B2I3 | 111-245 | REALNRHRDRLDEALLSNAFAWIKKSSEDGFDGMVQLLQLVLQLYAARQLATAEKEGVEGAVNQLLYAQEKQWTPLLRRLVAEGQLT… |
| V4L6R6 | 101-248 | None |
| A0A7J6FI95 | 170-314 | None |
| C1FIW0 | 1-131 | None |
| A0A7R9UQZ6 | 160-306 | None |
| A0A200Q6T9 | 190-336 | None |
| A0A068TL05 | 50-193 | None |
| A0A164V253 | 254-398 | None |
| A0A7S4D9J5 | 4-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.