DPCstruct | MC35573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 65.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6RF12 | 653-724 | ILEDQVSPKACGHTQGRKVVSREEAVMRIKAAVDARKESGSDIVIVARTDSRQAVSLDESLWRCRAFADVGA |
| A0A2V6USE5 | 201-269 | GVHIEDQQFPKRCGHIAGKTIVTREEAIGKYRAAVEVRNRQDPDFVIVARTDAFGAVGGSLDEAIWRGR |
| A0A396GUA9 | 114-182 | None |
| A0A446MHM0 | 344-412 | None |
| Q7XLP7 | 127-195 | None |
| A0A842SLM7 | 51-138 | None |
| A0A812XB70 | 44-115 | None |
| A0A1Y1HZA0 | 2-77 | None |
| A0A0E0KSI1 | 138-209 | None |
| A0A7J7NPS3 | 43-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.