DPCstruct | MC3557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 132 ± 25 aa |
| Standard deviation of domain lengths | 24.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E8CKC0 | 14-156 | GNPNDEFYRYKMSPLKIQVIGKGNGIQTILTNIEEVSNAIGHPTEIISKFISYNTGSNWNLSKKTLTGKHDLVTLQDYINEYIQSFV… |
| U1P2Q5 | 9-133 | QKTGFQFQMPLLQKDGAFTRLTNLSSIADALSRDPEHVHSNIQRELGTAGQYENGRARYNGNFSGDDFDDVLNAYIASYVTCTECGL… |
| A0A183J6F8 | 2-123 | None |
| A0A3L8E554 | 13-146 | None |
| A0A0G4N2M1 | 298-433 | None |
| A0A7S1UVI5 | 18-146 | None |
| A0A4Y7MJI3 | 497-621 | None |
| A0A7S2LIW6 | 11-151 | None |
| A0A2I0HMN1 | 1-86 | None |
| A0A7J2XC79 | 18-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.