DPCstruct | MC35566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 59.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6BFE2 | 189-247 | YEPIEDIDEQEELATIDANQNGVVSIAEAKAAGYKMPIYSDHWLYKYMTDADGDGKVGQ |
| A0A1Z9X2B7 | 32-92 | EQALQPDAAVQSPNALAVYDSNGNGRITCKEAREHGIAPVRRTHPAYRYMQDRDGDGIVCE |
| A0A2X0W4Q3 | 379-445 | None |
| A0A2J9PQ03 | 244-310 | None |
| A0A645K1Q8 | 2-67 | None |
| A0A0V8GBS1 | 75-139 | None |
| A0A4R7U1A3 | 248-314 | None |
| A0A2W4FPL6 | 6-87 | None |
| A0A1I0RDH4 | 330-395 | None |
| A0A1G9SI31 | 301-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.