DPCstruct | MC35560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8Z0Z8 | 27-125 | STRSIRAAVVSDLTPLRDLCQQLERVQAQAAALGLFVGNRDLLDCPNCKLFEDVTAEGLLITSRELATPPIDTGLRFSQVSSNTFQC… |
| A0A315B3R2 | 3-89 | KESDLRQFQALAAQLATTRAQVKAHGGFMGDRDLHQCPACSLMEDVLCGGKLVTCWHLSAQPVDTGLLFKEVGAEQLACPGCGCVSL |
| A0A7Y5FA15 | 2-84 | None |
| A0A533T0G7 | 1-113 | None |
| A0A1F9LQF9 | 2-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.