DPCstruct | MC3556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 169 ± 38 aa |
| Standard deviation of domain lengths | 37.60 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9VNU0 | 18-156 | TGVALSATLHCLTGCAIGEVTGMVIGTALGFSNLGTIALAVGLAFLFGYTLTSLPLLRAGFAVAVVIPIALASDTLSIAVMEIVDNG… |
| A0A1M4MYM4 | 18-162 | RKEISDDGDYRRAFRSVAHCYSGCGLGELTGLLITVGIFGASQWVVVLVTFMLAYAAGYALTVGPLLQDGVGLKSALKDAVFSETPS… |
| A0A846P8J6 | 61-257 | None |
| A0A836X8S6 | 34-173 | None |
| A0A318NJW7 | 111-327 | None |
| A0A6G8G3G5 | 2-130 | None |
| A0A3N4YPU6 | 97-247 | None |
| A0A1Z4JRW3 | 70-290 | None |
| A0A0G4MCY5 | 221-389 | None |
| C9SUA3 | 49-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.