DPCstruct | MC35558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 238 ± 57 aa |
| Standard deviation of domain lengths | 56.70 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 32.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9UA26 | 10-207 | MELARLAVDSGGDPGAIHRALDPTMLPVPDVEGSQKNKCQLTRTPYGRRFANEEINSYFAFLFELIAARGPSVGLKVSLSRFDLFHG… |
| D8SBM5 | 41-289 | TLRSSSYRSTGVSRVEKPDSKERMWRLIREPPASVANLARKSVEWAGEPDAILAELDSALHKVPDVENSNASKCVLTKHDCAKRFVD… |
| A0A1Y2HXG0 | 37-282 | None |
| A0A4S4EHD0 | 55-338 | None |
| C1DYW4 | 40-325 | None |
| A0A5J4YMV8 | 21-248 | None |
| A9TP89 | 98-385 | None |
| A0A812R948 | 8-180 | None |
| A0A6V7PCA5 | 3-191 | None |
| A0A7J0G8H5 | 151-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.