DPCstruct | MC35556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 3.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 65.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453F0S7 | 53-117 | AWKRGYLLYGPPGTGKSSMIAAMANYLKFDVYDLELTEVNWNSTLRRLLIGMTNRSILVIEDIDC |
| A0A835VB88 | 21-82 | LAMEPNLKTTIMEDLVRIVAMANYLRFDIYNLDLKEVRDNSGFNKLLAGMANQSLLVIEDMD |
| A0A0A9PDP5 | 119-174 | None |
| A0A6J0ZJ67 | 252-307 | None |
| A0A6A2Y1B0 | 111-175 | None |
| A0A218X095 | 20-84 | None |
| A0A6A6LK79 | 29-93 | None |
| A0A438I291 | 211-275 | None |
| A0A834YKW7 | 36-97 | None |
| A0A2P5DZ40 | 156-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.