DPCstruct | MC35549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 23 aa |
| Standard deviation of domain lengths | 23.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0EFV5 | 1-163 | MAVNRVSITINSRQYTVVAEESREYIERLGEHINEKVKNVLNGGQNVLGERPIVLAALNICDEYFKALESDDSVKVEIEKLNSKIDN… |
| A0A369B9U7 | 59-184 | AGKNKVHIRIGGKDYTLVGIEAEEYIQRVGLYIDKKINEITRSNSLLSTSMASILAAVNVADDFFKSRENEKRLEDELERACEELEK… |
| A0A3A9IYK4 | 125-245 | None |
| A0A446IEK3 | 2-157 | None |
| A0A6L5X489 | 3-143 | None |
| A0A2N2EJA3 | 7-144 | None |
| M9M1D5 | 7-170 | None |
| A0A3C1H646 | 1-145 | None |
| A0A1M6GYZ3 | 1-208 | None |
| A0A7C6D2I0 | 57-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.