DPCstruct | MC35544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 84 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0MQL7 | 1-78 | MHRIDTSTAQKDKFGQGKNGFTNGDPTTGTPSTKLNSDIYDALQEEVCTVVERSGIRLNKSQHYQLYRAIKKLSETEA |
| A0A0B1MCN5 | 1-88 | MHRIDTKTAQKDKFGAGKNGFTRGNPQTGTPATDLDDDYFDMLQEELCSVVEASGASLEKGRHDQLLTALRALLLSRKNPFSDIKSDG |
| A0A381KSX8 | 1-76 | None |
| A0A7I8C621 | 1-80 | None |
| A0A6S5WYA3 | 3-81 | None |
| A0A378AY34 | 1-81 | None |
| B6I7Q3 | 1-80 | None |
| A0A1A9G110 | 1-73 | None |
| A0A3S0BXM9 | 1-85 | None |
| A0A3S3EGM0 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.