DPCstruct | MC3554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 213 ± 26 aa |
| Standard deviation of domain lengths | 25.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7IDE1 | 57-260 | QAEDILTQLDKSATDFAFPDLGHGYFFAVDARMHLFRGPERWALIVETVGYNPRMENLIDVVHVFGNCLTTGGPGFVDEDFLDRVEN… |
| A0A7C2JQD2 | 1-239 | MKAEDILCLLDEHIEPGAEIDNFYQEIADTRLTVFRSEEYWAIFFEFVGNHITYVDAANYIYAYGNCLKNLGYLGPEASLALFATPE… |
| A0A6H2YHM0 | 4-218 | None |
| B0CG16 | 91-298 | None |
| A0A6N6L4V8 | 21-263 | None |
| A0A2H5WYQ7 | 36-280 | None |
| A0A7Y5U8W6 | 5-239 | None |
| A0A2W7B126 | 2-187 | None |
| A0A842F6N2 | 1-221 | None |
| A0A7Y7AFN7 | 170-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.