DPCstruct | MC35539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 156 ± 27 aa |
| Standard deviation of domain lengths | 27.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 39.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8JGZ4 | 3-163 | WKKHWNDAQHAACAHLTLQVAYFGDSMRSDVFPATIFGKWETVMVVEEMEGDGVPKSDAAVSNEAQVEPQEKRGKFEGQGMKSPSAG… |
| C3YI07 | 100-222 | KVVYIGDSLRSDIFPPKKFANWSTVLICEEMEAEGMEEDRENDYDPASRAILVSDMWGPFLTDRSTSGSEVVTVCGHILRSSADICV… |
| K1PJZ5 | 180-348 | None |
| A0A3S1B7T3 | 227-384 | None |
| A0A6P8HBX2 | 5-227 | None |
| A0A5J5CMU6 | 2-142 | None |
| A0A3Q0DU72 | 576-736 | None |
| A0A817RNU7 | 1-184 | None |
| A0A822HYL3 | 124-290 | None |
| R0KVG7 | 5-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.