DPCstruct | MC35538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U9CG78 | 232-291 | ILDGAPLIAIHKARYYKRTDGLALGPGPFVTGLEYAADCKATVVGKPEKTFFTQVRNSFH |
| A0A538HY81 | 134-198 | LEAGADLYCLHKNRWWQTRQGPLLDAGAFVAGLEYAAETDATVLGKPSPAYFEAALEALDADANM |
| A0A812DV80 | 128-199 | None |
| A0A6H5GPT1 | 75-143 | None |
| A0A2I0T531 | 1-71 | None |
| A0A4W2ID72 | 145-211 | None |
| A0A507FGD1 | 149-208 | None |
| A0A6A4C6J4 | 267-331 | None |
| A0A4W2E1P9 | 145-211 | None |
| K1VTT4 | 248-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.