DPCstruct | MC35535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 288 ± 50 aa |
| Standard deviation of domain lengths | 50.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TXC1 | 2-220 | NLAVSLLVLVILVLLNSPVLDSMRISVNSHMARYQSGKNTSDQVTIYMLEQSGRYGRAALESLKSDAGFMKDPKRARDLLMALDGEQ… |
| A0A8B3V9S3 | 111-385 | PVLAGWALWLRISQYGWSPERLYGVLITIVALVWAIGFCASALIQRREPQKIHAYVIPATGLLSLIFLALVHTPVLDPWRISVASHM… |
| E7STW5 | 81-464 | None |
| A0A381GBS3 | 33-305 | None |
| A0A7X1NZA1 | 189-574 | None |
| A0A0N4ZIQ1 | 435-718 | None |
| A0A7C6FK11 | 2-297 | None |
| A0A357MKV7 | 395-701 | None |
| A0A438AJC8 | 303-582 | None |
| A0A5J4ECD7 | 5-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.