DPCstruct | MC35534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 51 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 43.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6TN48 | 1-41 | MKVKPKYRDPQSGHTWTGRGLQPRWIKEALASGGTLERLLI |
| A0A7C6FDX3 | 1-58 | TKPRKSRKAKPASDGRAKVAPKYANPANPDEKWTGRGRGPKWMQAHLEAGGSKDDYLI |
| Q606Z8 | 59-112 | None |
| A0A3M1FPQ2 | 80-123 | None |
| A0A855HDU1 | 1-40 | None |
| A0A355YG01 | 61-116 | None |
| A0A5C7NM34 | 105-169 | None |
| A0A6I0EEN8 | 74-123 | None |
| A0A7C2LUV5 | 88-134 | None |
| A0A7Y2W9V8 | 137-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.