DPCstruct | MC3553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.18 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0040- CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2DU00 | 123-203 | GYSSEDINERFGQILESFEYGAPPHGGIAPGIDRLIAILVGSTSIRDVIAFPKTQTGADLLFGSPAPVEPDQLKELELRLL |
| A0A5M4DD40 | 172-242 | PRGGAEALRQGAPPHGGIAPGIDRLAMMLCDEENIREVIAFPKVGQGLDPLMGAPSEIDNAQWNELGIRLK |
| A0A4S4DT31 | 222-299 | None |
| A0A368F502 | 42-123 | None |
| A0A7C1P5E9 | 11-83 | None |
| A0A1E3GXU7 | 1-57 | None |
| A0A376F9T5 | 48-125 | None |
| A0A800BQK8 | 93-178 | None |
| A0A7J7IHE1 | 59-137 | None |
| A0A831W4B8 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.