DPCstruct | MC35529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4LJV7 | 1-69 | MWATDDYKEASSLHQANAEITVASITGKYSELIALRIAKSRDLQASRAKGKAEAFTPSWICNEQNNLVD |
| A0A416I8C2 | 1-94 | MEEVDIIEQSIADMSGDLLRILLIDKTTKKYIRWATDNYVSLGEDCSAGVEIKPEFITGDYTNVIQPRVAKSQVEQMKRTRDKAEVF… |
| A0A2V2GJT3 | 1-94 | None |
| A0A255SXA7 | 5-104 | None |
| A0A7T9F1I8 | 6-84 | None |
| W1SQL8 | 14-136 | None |
| J1NY81 | 4-91 | None |
| A0A7X9KYI8 | 2-92 | None |
| E0NWU6 | 2-93 | None |
| A0A3C2EEH9 | 3-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.