DPCstruct | MC35523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 157 ± 23 aa |
| Standard deviation of domain lengths | 22.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5UF42 | 345-516 | AANNVWCCSDPMSREPTLMFSLDKPQPLRQPLLTLTPVWSTKSRLLHQDVTRQIEHCLTKAKASTLHCQVLLLPRQMTIRVGQDVVR… |
| A0A0S7HX84 | 2-115 | ECCLTEAKPSVLRCQVLLLPRNMITRVGHHILHSSANEPCGLRGASIRLYVEGKEGLKSVGTVVPDPDVTPTFELSVVFKVDKEDGW… |
| A0A5B7D1P5 | 2-109 | None |
| F6YVX5 | 31-181 | None |
| T1E2W8 | 79-241 | None |
| A0A3S1A8X1 | 38-210 | None |
| A0A7J7VB43 | 25-190 | None |
| A0A182J3T3 | 140-294 | None |
| A0A672YM03 | 31-157 | None |
| V4B155 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.