DPCstruct | MC3552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 187 ± 40 aa |
| Standard deviation of domain lengths | 40.20 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0300- CL0308 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1P2G7 | 253-428 | FSGFAMVSLLLIILRRVCKLQQYITLQHINLINSIILVTGSLVAVAYLTELFVALLSGNPHELFVFSNRATGAYAWAFWLMVVCNVC… |
| A0A7C5XAH0 | 28-214 | MAGISGIGLIMVVAYILRKIYKLEELIGERTFYTLGFILFVLLTIYLYFTVVEELTAHYAAPEKDRYIAHQITIGKFAPIFWINVVS… |
| A0A838RCH9 | 1-125 | None |
| A0A379FKC4 | 16-215 | None |
| A0A5C6TZ56 | 171-393 | None |
| A0A2V5VDU2 | 207-441 | None |
| D0JBN9 | 203-369 | None |
| A0A519N700 | 11-190 | None |
| A0A257VCV2 | 148-363 | None |
| A0A2E4PS18 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.