DPCstruct | MC35518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 128 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5U3L3 | 237-351 | AIRCTLVNCTCECFQPGKIHLRTCDQCKHGWVAHALDKLSTQHLYHPTQVEIVQSNVVFDISSLMLYGTQAVPVRLKILLDRLFSVL… |
| A0A6P6M6Y0 | 32-167 | DEVVGCTHAECPCECFLPGPAQIRSCDRCAHGWVVHAVGKLCAPALLCSGQVEIVQSNVVFDISSLILYGTQALPVRMKILLDRLFS… |
| A0A6P8GYA7 | 11-170 | None |
| A0A672F5G3 | 6-102 | None |
| A0A3B5M1K7 | 22-168 | None |
| A0A4Z2D6U2 | 11-135 | None |
| A0A6P7U151 | 7-126 | None |
| A0A3Q2PIZ5 | 1-112 | None |
| A0A834FD77 | 117-227 | None |
| A0A814JR09 | 10-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.