DPCstruct | MC35517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 156 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3DFQ0 | 1-131 | MQSVDAKLSRSSLLLALQRYSTSVHNMEQTILLPSLLRDIPYNDAPGATDNSMDLYENYLMLKDIKNMVESGLVPHEDGEYHTCLQK… |
| A0A4U5TZD9 | 5-156 | LQETSPNQKNSLFNAMNRFIGAVNNMDQTIMLPSMLRDVPLEEDRHMSPLKSSDEDEGDMYSYYQLLKSIRRDIEWGVRCAAADEMR… |
| A0A3Q2UBH2 | 2-123 | None |
| H3B5H1 | 1-143 | None |
| A0A482VU49 | 1-161 | None |
| A0A6V7HHD9 | 55-251 | None |
| A0A0F8CJ52 | 92-201 | None |
| A0A833W9Y1 | 13-192 | None |
| A0A146VP35 | 46-180 | None |
| A0A7R9J392 | 2-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.