DPCstruct | MC3551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J8F9X0 | 1-96 | MDIHKLTEAEAKEINTWKYEEPYTLYSFSGEAEVIEELLDGTYYGCCDEKGEFIGYFCFGENAQVPGGRDANLYAGEDVVDIGIGMK… |
| A0A2T0WA79 | 1-87 | MKIQQLSQENAVDIANNWRYDGIYSFYDADADKEDYEELVTPELRENSYFEVLENKALIGFFSVDYDSDKKTVDLGLGMKPSLTSKG |
| A0A653SVD8 | 1-81 | None |
| A0A254NXL1 | 11-119 | None |
| A0A2S6FWL7 | 1-98 | None |
| A0A1S8R170 | 1-103 | None |
| A0A510TXG9 | 6-91 | None |
| A0A7I7SYP9 | 6-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.