DPCstruct | MC35500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 181 ± 21 aa |
| Standard deviation of domain lengths | 20.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A651E5L3 | 240-413 | EVDHLRQQIQELEGLADAYDPELNAHRVQEYDALVAENARLKAEHDALAQQLGHIHQVVNASAAQKPAAKQGKRASQPAVATADSGH… |
| D6U227 | 1-143 | MAYLHQLVRQDRLQQGMSEALVSYEQLPYSHLVGIQTRAARRERWRRAVWTIMMHNRACVRSEDRWYMNYWAVLALAGGDPLGVGRY… |
| A0A832H864 | 62-209 | None |
| A0A2N6LG55 | 125-336 | None |
| A0A2T1LVS0 | 18-157 | None |
| A0A3M1P750 | 160-348 | None |
| E0UMW7 | 77-264 | None |
| A0A844MUR3 | 104-300 | None |
| A0A838VGV4 | 108-290 | None |
| A0A6P0KEA9 | 5-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.