DPCstruct | MC355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7P0M3 | 3-79 | HPMQDIEKDTNGVIRFRRNAIVRALLDTGKLNLNDLALLPFSDEDHRQFAQLIGYSISGYGDLPYVSDADVEAANAA |
| A0A158B317 | 1-97 | MEPKHPMQPLVRDDRNTVRFKRNHIVEYLLDNGGIDMNKLAMLDFTPEDRQQFAQLIGYSVDGYMTLSYVMNDDEAWNATEAAWVAF… |
| A0A1R3FRG1 | 108-176 | None |
| A0A839D434 | 9-95 | None |
| A0A7W8VZL9 | 249-340 | None |
| A0A2N7NCR9 | 86-170 | None |
| A0A7L6ET95 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.