DPCstruct | MC35498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 189 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850M938 | 2-174 | LSALGSIAVGFLLGIAVEDIFAILPGLIVLVPPLMSIRGAIGGAFSARLSTALHLGTVKPQVRNNTSNFKKSFLAAILLTAILPIWI… |
| A0A151UEB7 | 8-178 | ILLLYQKRVFWLVFLVFGSLLSGLGIAHFEDLIAAHIVLVFFLPLLVGSGGNAGSQSATLMVRALATGDVHFKDWFYLLGRESLVAL… |
| A0A3A5JCU0 | 174-377 | None |
| A0A7S1PHN3 | 134-344 | None |
| A0A1V9YTL6 | 32-211 | None |
| A0A0R3QT67 | 116-323 | None |
| A0A7X1GMK4 | 542-718 | None |
| A0A847A8M5 | 1-131 | None |
| A0A2B4S1R6 | 393-566 | None |
| A0A835CQU2 | 810-1057 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.