DPCstruct | MC3549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 303 ± 25 aa |
| Standard deviation of domain lengths | 25.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 42.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9GX69 | 7-309 | QKAFCDLESEVKNLRLAIGDIHLNHRSLVRELQSHRDIDAKNKAELKRLKGELEIAVAELQVSNCKLATLKAERDATKGACFPVLNL… |
| A0A446NVK5 | 9-313 | ERSRELRTTGTELSLQLNDAIQELSDLHLKHRRLTEKHHEERFLNARSKAEQKRLKEELASAVAKLEESNHKLAVLKAQGDPTHGTP… |
| A0A1P8AYB9 | 200-498 | None |
| A0A072U9D3 | 199-501 | None |
| A0A2I0JFJ9 | 4-241 | None |
| A0A7J9IVH4 | 167-465 | None |
| A0A443NCG2 | 2-331 | None |
| A0A0A9QZX4 | 56-388 | None |
| A0A453FYF0 | 198-502 | None |
| A0A446WGX2 | 1-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.