DPCstruct | MC35489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 14.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831RI09 | 7-70 | YTPYNTYRIGGLPPTPIAIPGLASIRAVLHPATGKALYFVARGDGTHVFSQTLAEHDRAVGRYL |
| K2F1A1 | 12-81 | KDLRTPTPYNTYTISGLPPTPIALPSKKAIEAAMHPDNSDNLYFVATGNGGHKFTSNLNDHNKAVQEYLT |
| A0A7X3VLI3 | 105-181 | None |
| T0CRF2 | 71-150 | None |
| A0A7T5RK43 | 471-549 | None |
| A0A7V3SYZ9 | 1-56 | None |
| K2DEN2 | 4-59 | None |
| A0A7C1KXQ6 | 33-106 | None |
| A0A0Q0AT66 | 94-186 | None |
| A0A2M8Q3D6 | 364-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.