DPCstruct | MC35484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 197 ± 23 aa |
| Standard deviation of domain lengths | 23.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7UNI4 | 13-204 | FAIHFGISLVIFLVLAWFIIVKWYPIPFFSTDGGWQGIRIVAAVDLILGPLLTLIVYKHGKPGLKLDLTLIGLAQAMALTWGVWVTY… |
| A0A0T2ZHS7 | 25-213 | ALGHFVVSAIAVALAASLVFLAWYPAPWRQMLGVAAIFGVVVAVDLVCGPMLTFVLASPRKTRRERWVDLTLIALIQLSALGYGLWS… |
| A0A812RX70 | 266-472 | None |
| A0A2N1I4T7 | 4-204 | None |
| A0A1Y5HDX9 | 7-213 | None |
| A0A7X3NL23 | 51-292 | None |
| Q8KQ30 | 2-167 | None |
| A0A7X9TYN0 | 1-159 | None |
| A0A1H2N657 | 5-186 | None |
| A0A1G6KHE0 | 2-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.