DPCstruct | MC35482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 5.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6BUK4 | 11-97 | ALATVTAGAAHASSDDAWAAFDARVAKACREASGFQRARTSAIVGFDDRVGRVAVLVGDRAGKMPPKLCLYDKRAQKAYVDEAAGWS |
| A0A3D3M403 | 1-100 | MKASILTLLLLAPLAHASSDQAWADHDKQLLRACTAASQLKDVRALGKSAEFDDRSGYSALLLQGRYPQKHMNNLKGTELCLYDRRQ… |
| A0A259AZF3 | 2-88 | None |
| A0A369U956 | 1-91 | None |
| A0A1A9FXS2 | 4-104 | None |
| A0A2W6S813 | 4-101 | None |
| A0A261VZR0 | 19-107 | None |
| A0A1S8CXY9 | 1-92 | None |
| A0A1Q8SUU4 | 15-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.