DPCstruct | MC35480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 229 ± 21 aa |
| Standard deviation of domain lengths | 21.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3JIT4 | 28-251 | LTAHFNNLSYHASESAKIAAELEAEQAELLDEEYFCEVNNEPFQKYEYLHQIDRRIEKQKIDADEYCKDLVACFQIIRKLIRIEEQR… |
| A0A2T4DXM1 | 8-228 | LFTSNKQSEKCMRLQDEISTITERLEQIDRDEYIANAKGMKFDQAERVSLEAEQRKLESEYESAAKKMDMFLCDLQSCYKLIRMCVS… |
| A0A0Q0J606 | 157-387 | None |
| A0A7I6TS17 | 2-236 | None |
| A0A1Q9H6P3 | 67-315 | None |
| A0A416F974 | 683-895 | None |
| A0A8B4RNV7 | 496-732 | None |
| N9PDX2 | 2-213 | None |
| A0A241PNI7 | 307-531 | None |
| A0A7R6W6R3 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.