DPCstruct | MC3548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 15.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0Y518 | 10-160 | VLNLDKCIGCHTCSVTCKNVWTSREGMEYAWFNNVESKPGVGFPNDWENQEKWKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPG… |
| K0YSE5 | 1-133 | MKVMAQIAMVMNLDKCIGCHTCSVTCKQAWTNRDGTEYIWFNNVETKPGIGYSKRWEDQEKYRGRWKLKHGKLTPSLGGRAHLLSTI… |
| A0A3S4K534 | 149-266 | None |
| A0A3S5D877 | 1-117 | None |
| A0A0C2MKV8 | 1-150 | None |
| F9EIH6 | 8-161 | None |
| A0A377E413 | 6-127 | None |
| A0A7S9HEQ9 | 1-104 | None |
| A0A533IW78 | 8-161 | None |
| A0A1Z1WSB6 | 576-723 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.