DPCstruct | MC35476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.00 |
| Pfam Score | 68.18 |
| Assigned Pfam label(s) | CL0198- CL0021- PF03119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VHZ0 | 1-67 | VMPTHCPECGTELRPEKDSDADIRCPNTESCPAQLRERLFHLAGRGSFDIEALGYEAATALLTSGVI |
| A0A378VZ83 | 40-114 | LPARCPICRSEIEREEGEAVARCSGGMLCQAQRAQGLIHFASRKAMDIDGLGEKQIEQLVAQDLVRHFADLYRID |
| A0A7V4UW92 | 164-230 | None |
| A0A837I3J9 | 65-137 | None |
| A0A7S1YQA6 | 257-341 | None |
| W3Z9Y8 | 84-159 | None |
| A0A837Q3Q1 | 214-279 | None |
| T2RE53 | 1-74 | None |
| A0A1V1NVE1 | 171-244 | None |
| A0A538SCI7 | 645-711 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.