DPCstruct | MC35473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 47 ± 5 aa |
| Standard deviation of domain lengths | 5.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 62.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02622 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401FSR8 | 7-58 | LSLKGEFLIAMPGLDDPNFSHTVVCICEHTEDGCVGIIINRTYPTLFAKDIF |
| A0A4R4GG28 | 1-48 | MNLTNHFLVAMPGMKDPYFKRSVIYICEHNQDGAMGLMISSPIEITVE |
| A0A498F7G4 | 19-64 | None |
| A0A7Z7KMS5 | 1-35 | None |
| A0A379BXD3 | 1-40 | None |
| A0A2U0T6E7 | 1-51 | None |
| A0A6D0M914 | 1-44 | None |
| A0A6N8Q3B8 | 25-67 | None |
| C0AXX7 | 1-52 | None |
| A0A448QNW1 | 175-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.