DPCstruct | MC3547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841Q2T3 | 12-75 | LSADPKAEQCGWLKDKYGVSWQIWPMIMGEMMANGTNEQLDRLIKAFLQMKKFYIEKLNRLITV |
| A0A0Q5HLL0 | 58-133 | FTESISLVVRCADQAEIDRFWAKLSHVPESEQCGWCKDQFGLSWQIIPANMDDLTRTPAQIQVMMGQKKIVIAELE |
| K2G3F6 | 96-170 | None |
| Q3JM19 | 509-583 | None |
| A0A3S5EM66 | 269-336 | None |
| A0A0N1HKG4 | 389-463 | None |
| A0A2U3L2X9 | 94-168 | None |
| A0A167GTL5 | 26-105 | None |
| A0A7W6D4T4 | 6-62 | None |
| A0A5P3A078 | 31-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.