DPCstruct | MC35467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 155 ± 34 aa |
| Standard deviation of domain lengths | 34.44 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5BIL2 | 1-84 | MGLCKCPKRKVTTLFCYEHRVNVCEYCMIDNHKSCVVQTYLDWLSDSGYDSFCILCNQSFTERDTIRLKCLHLFHKDCLHAREA |
| A0A2K3NNC1 | 1-118 | MVVCKCRKATKLYCFVHKVPVCGECICFPEHELCVIRTYSEWVIDGEYDWPPKCCQCQAIIEEGSGSQTTRLGCLHVIHTNCLVSHI… |
| A0A4Z2B0A6 | 1-178 | None |
| A0A445IST1 | 1-180 | None |
| A0A6P5G5H9 | 1-107 | None |
| A0A7R9ATT2 | 1-167 | None |
| A0A6H5HA42 | 25-181 | None |
| A0A5S9WY32 | 1-167 | None |
| A0A814EM17 | 1-199 | None |
| A0A4P9XBG9 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.