DPCstruct | MC35464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 307 ± 85 aa |
| Standard deviation of domain lengths | 84.64 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.73 |
| Pfam Score | 80.93 |
| Assigned Pfam label(s) | PF00542- PF04561- CL0410- PF04563- PF04565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3NKU4 | 15-376 | TKFQIDSFNNFVNVDLKRTVDVNGFITVKLSTDDENQFSLRLLDARIGRDDITRTPLECRSCDLTYTAPILVDIEYSQGRRDEILTR… |
| W1DQD2 | 5-214 | PQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVIY… |
| A0A2A2KTH8 | 1-246 | None |
| A0A1V5JVL6 | 4-327 | None |
| Q8HTL6 | 162-693 | None |
| A0A1P8BFS9 | 46-403 | None |
| A0A1I8F8V7 | 161-416 | None |
| A0A345HH11 | 52-292 | None |
| A0A820V5C5 | 18-293 | None |
| A0A1D6DWV2 | 57-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.