DPCstruct | MC35459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 187 ± 28 aa |
| Standard deviation of domain lengths | 28.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5PJY5 | 19-220 | KNHRGKAIAKFPERKEEFKTSSEIEIKPIYTPEDVKDIDYLEKLGFPGEYPYTRGVQPTMYRGRFWTMRQYAGYGTAEESNKRFKYL… |
| A0A2X2IAM8 | 5-177 | QEWQQLANKELSRREKTVDSLVQQTAEGIAIKPLYTEADLDNLEVTGTLPGLPPYVRGPCATMYTAQPWTIRQYAGFSTAKESNAFY… |
| H6SM39 | 210-411 | None |
| A0A6G3UZZ2 | 2-149 | None |
| A0A2J6WBH4 | 471-680 | None |
| A0A535AGQ0 | 4-190 | None |
| A0A7J5D4P2 | 32-176 | None |
| A0A450XY86 | 16-181 | None |
| A0A371SHF4 | 5-197 | None |
| A0A7Y2VEZ3 | 155-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.