DPCstruct | MC35457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7F9K0 | 1-73 | MIYLLTKEGCALIYHEFYKILERTYPKLDVLQELHAMQAWLYINPDTHKSFGHIGHFVNSWLKRNGKQGQTRR |
| A0A3A9EEX7 | 1-90 | MTFPLKDGGCYPVSTEQCRRWAELYPAVDVEQQLRNMRGWLEANPQKRKTRAGILRFANGWLAREQNQVGQSRLSPTGSQTPDYGRE… |
| A0A1C2Y2C6 | 17-99 | None |
| A0A2Z3R5E9 | 2-114 | None |
| Q2NTS2 | 272-361 | None |
| T5LYS8 | 25-116 | None |
| A0A193QL83 | 28-136 | None |
| A0A520TRF7 | 1-89 | None |
| A0A2Z5FT69 | 170-263 | None |
| A0A6L8K7P1 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.