DPCstruct | MC35456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 148 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6TH44 | 3-148 | LQEMKFYCPLEISRWDDDEYNEISPNEASAYESEINYFISDFNLPEEKERGLMHWYNRGNSVDQKVFSAFMSVEENDEELVGVVTAS… |
| A0A3A9EE56 | 16-136 | VKLTFYCPLVGQLDDGECDEYIDIGSGFLAAYQDQIEQAIANEQVPEMGDMTQYLGDDPGVAEKLMSAVWIVEDMDGKLFGRIDCHL… |
| A0A1V5XD07 | 232-379 | None |
| A0A845RK54 | 73-224 | None |
| A0A645C801 | 16-180 | None |
| A0A1Y4HAF4 | 60-214 | None |
| A0A3R6L9X0 | 7-157 | None |
| A0A1M6I5T4 | 4-180 | None |
| A0A6I7GJ83 | 85-230 | None |
| A0A0W1JGX2 | 97-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.