DPCstruct | MC35454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 482 ± 107 aa |
| Standard deviation of domain lengths | 107.12 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1VG31 | 161-696 | GRASGIYSFDISPWCIGWILGVESSKQFVNTTNICNPDKTHYKGEYISANNIQPFEVFWAMTADYTVSYEMTNYKTQRPISFSNWLT… |
| A0A7X8ZLY6 | 83-542 | MSFTNWPTTDILEHPSNFQDSEDLVSIDPNVIYTKEEMDLAGQFASYHVYPYYPDFLNVEERYVNYVDHRGENNNYAGYLNHLNSVH… |
| A0A1T4PJZ7 | 176-696 | None |
| A0A7V4Y7L7 | 280-845 | None |
| A0A2P6NKP6 | 403-936 | None |
| A0A6G4RD41 | 1-383 | None |
| A0A437SNX7 | 453-987 | None |
| A0A0Q0ZQR8 | 1-535 | None |
| A0A1F2SSI3 | 358-957 | None |
| A0A538MM66 | 38-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.