DPCstruct | MC35451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 465 ± 100 aa |
| Standard deviation of domain lengths | 100.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 73.29 |
| Assigned Pfam label(s) | CL0004- CL0126- PF00066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3AAN1 | 2-407 | FAGLFDNCSHSLSDKGWTLGIQSSDHLGRKDACFFFTMRTDRARKATTVLGHSHYLPNVWVHVAATYDGHWMTLYVDSVQVGRSGGQ… |
| A0A812DJL5 | 25-432 | PRVFFSYRTLSTYSRCFSATVPDALLTFNIFYFFSFLGLFDMCHQDHKAKGWNIGIRTYEEGQEEGARIYFSLETDRANSPSVLMSD… |
| F1Q5Q4 | 55-527 | None |
| A0A6A5F4D5 | 229-683 | None |
| A0A401SDD0 | 6-528 | None |
| A0A6J0VA35 | 7-415 | None |
| A0A0B2UZL6 | 1-554 | None |
| A0A0H5S603 | 5-305 | None |
| A0A498MT86 | 22-485 | None |
| A0A0V0Y441 | 264-703 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.